KIF5B antibody (N-Term)

Catalog No. ABIN634172

Product Details anti-KIF5B Antibody

Target: KIF5B (Kinesin Family Member 5B (KIF5B))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KIF5B antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: KIF5 B antibody was raised against the N terminal of KIF5

Purification: Affinity purified

Immunogen: KIF5 B antibody was raised using the N terminal of KIF5 corresponding to a region with amino acids CNIKVMCRFRPLNESEVNRGDKYIAKFQGEDTVVIASKPYAFDRVFQSST

Application Details

Application Notes: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KIF5B Blocking Peptide, catalog no. 33R-1753, is also available for use as a blocking control in assays to test for specificity of this KIF5B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KIF5B

Target: KIF5B (Kinesin Family Member 5B (KIF5B))

Alternative Name: KIF5B (KIF5B Products)

Background: Kinesin is the founding member of a superfamily of microtubule based motor proteins that perform force-generating tasks such as organelle transport and chromosome segregation. Kinesin consists of heavy and light chains both of which have been documented to bind a variety of potential linker or cargo proteins. KIF5B is an isoform of kinesin heavy chain.

Molecular Weight: 110 kDa (MW of target protein)

Pathways: Peptide Hormone Metabolism, Ribonucleoprotein Complex Subunit Organization