KIF19 antibody (N-Term)

Catalog No. ABIN634163

Product Details anti-KIF19 Antibody

Target: KIF19 (Kinesin Family Member 19 (KIF19))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KIF19 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FLJ37300 antibody was raised against the N terminal Of Flj37300

Purification: Affinity purified

Immunogen: FLJ37300 antibody was raised using the N terminal Of Flj37300 corresponding to a region with amino acids EVSMSYLEIYNEMIRDLLNPSLGYLELREDSKGVIQVAGITEVSTINAKE

Application Details

Application Notes: WB: 0.125 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FLJ37300 Blocking Peptide, catalog no. 33R-2807, is also available for use as a blocking control in assays to test for specificity of this FLJ37300 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ37300 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KIF19

Target: KIF19 (Kinesin Family Member 19 (KIF19))

Alternative Name: FLJ37300 (KIF19 Products)

Synonyms: KIF19A antibody, flj37300-a antibody, Kif19a antibody, RGD1559936 antibody, Kif19 antibody, kinesin family member 19 antibody, kinesin family member 19 S homeolog antibody, kinesin family member 19A antibody, KIF19 antibody, kif19 antibody, kif19.S antibody, Kif19 antibody, Kif19a antibody

Background: FLJ37300 is a hypothetical protein found on chromosome 17.

Molecular Weight: 62 kDa (MW of target protein)