ORC4 antibody
-
- Target See all ORC4 Antibodies
- ORC4 (Origin Recognition Complex, Subunit 4 (ORC4))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ORC4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ORC4 L antibody was raised using a synthetic peptide corresponding to a region with amino acids VLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFVQRKAHSVYNFEKPVV
- Top Product
- Discover our top product ORC4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ORC4L Blocking Peptide, catalog no. 33R-9651, is also available for use as a blocking control in assays to test for specificity of this ORC4L antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ORC0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ORC4 (Origin Recognition Complex, Subunit 4 (ORC4))
- Alternative Name
- ORC4L (ORC4 Products)
- Synonyms
- ORC4L antibody, ORC4P antibody, Orc4P antibody, Orc4l antibody, mMmORC4 antibody, CG2917 antibody, DmORC4 antibody, Dmel\\CG2917 antibody, ORC antibody, ORC4 antibody, dmOrc4 antibody, orc4 antibody, rDmORC antibody, orc4l antibody, fc50c03 antibody, wu:fc50c03 antibody, zgc:85772 antibody, ATORC4 antibody, F23H14.9 antibody, F23H14_9 antibody, ORIGIN RECOGNITION COMPLEX SUBUNIT 4 antibody, origin recognition complex subunit 4 antibody, origin recognition complex subunit 4 antibody, origin recognition complex, subunit 4 antibody, Origin recognition complex subunit 4 antibody, origin recognition complex subunit 4 L homeolog antibody, origin recognition complex subunit Orc4 antibody, ORC4 antibody, Orc4 antibody, orc4.L antibody, orc4 antibody, CNM01830 antibody
- Background
- The origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells.
- Molecular Weight
- 50 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA
-