KIF9 antibody (N-Term)

Catalog No. ABIN634155

Product Details anti-KIF9 Antibody

Target: KIF9 (Kinesin Family Member 9 (KIF9))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KIF9 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KIF9 antibody was raised against the n terminal of KIF9

Purification: Affinity purified

Immunogen: KIF9 antibody was raised using the N terminal of KIF9 corresponding to a region with amino acids MGTRKKVHAFVRVKPTDDFAHEMIRYGDDKRSIDIHLKKDIRRGVVNNQQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KIF9 Blocking Peptide, catalog no. 33R-6083, is also available for use as a blocking control in assays to test for specificity of this KIF9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KIF9

Target: KIF9 (Kinesin Family Member 9 (KIF9))

Alternative Name: KIF9 (KIF9 Products)

Synonyms: RGD1565187 antibody, si:dkey-86l18.8 antibody, kinesin family member 9 antibody, si:dkey-86l18.8 antibody, KIF9 antibody, Kif9 antibody

Background: KIF9 acts as a regulator of podosomes and of podosomal matrix degradation in primary human macrophages.

Molecular Weight: 90 kDa (MW of target protein)