BCAT1 antibody (N-Term)

Catalog No. ABIN634139

Product Details anti-BCAT1 Antibody

Target: BCAT1 (Branched Chain Amino-Acid Transaminase 1, Cytosolic (BCAT1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BCAT1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: BCAT1 antibody was raised against the N terminal of BCAT1

Purification: Affinity purified

Immunogen: BCAT1 antibody was raised using the N terminal of BCAT1 corresponding to a region with amino acids MKDCSNGCSAECTGEGGSKEVVGTFKAKDLIVTPATILKEKPDPNNLVFG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BCAT1 Blocking Peptide, catalog no. 33R-6125, is also available for use as a blocking control in assays to test for specificity of this BCAT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BCAT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BCAT1

Target: BCAT1 (Branched Chain Amino-Acid Transaminase 1, Cytosolic (BCAT1))

Alternative Name: BCAT1 (BCAT1 Products)

Synonyms: fj66g02 antibody, zgc:73157 antibody, wu:fj66g02 antibody, Bcatc antibody, BCATC antibody, BCT1 antibody, ECA39 antibody, MECA39 antibody, PNAS121 antibody, PP18 antibody, BCATc antibody, Eca39 antibody, branched chain amino-acid transaminase 1, cytosolic antibody, branched chain amino acid transaminase 1 antibody, branched chain amino-acid transaminase 1, cytosolic L homeolog antibody, branched chain aminotransferase 1, cytosolic antibody, bcat1 antibody, BCAT1 antibody, bcat1.L antibody, Bcat1 antibody

Background: This gene encodes the cytosolic form of the enzyme branched-chain amino acid transaminase. This enzyme catalyzes the reversible transamination of branched-chain alpha-keto acids to branched-chain L-amino acids essential for cell growth.

Molecular Weight: 43 kDa (MW of target protein)