GSPT2 antibody (N-Term)
-
- Target See all GSPT2 Antibodies
- GSPT2 (G1 To S Phase Transition 2 (GSPT2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GSPT2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GSPT2 antibody was raised against the N terminal of GSPT2
- Purification
- Affinity purified
- Immunogen
- GSPT2 antibody was raised using the N terminal of GSPT2 corresponding to a region with amino acids MALEESWEHSKEVSEAEPGGGSSGDSGPPEESGQEMMEEKEEIRKSKSVI
- Top Product
- Discover our top product GSPT2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GSPT2 Blocking Peptide, catalog no. 33R-5685, is also available for use as a blocking control in assays to test for specificity of this GSPT2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSPT2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GSPT2 (G1 To S Phase Transition 2 (GSPT2))
- Alternative Name
- GSPT2 (GSPT2 Products)
- Background
- GSPT2 is closely related to GSPT1, a GTP-binding protein that plays an essential role at the G1- to S-phase transition of the cell cycle in yeast and human cells. GSPT1 is a positive regulator of translational accuracy and, in a binary complex with eRF1, functions as a polypeptide chain release factor.GSPT2 is closely related to GSPT1, a GTP-binding protein that plays an essential role at the G1- to S-phase transition of the cell cycle in yeast and human cells.
- Molecular Weight
- 69 kDa (MW of target protein)
-