GSPT2 antibody (N-Term)

Catalog No. ABIN634138

Product Details anti-GSPT2 Antibody

Target: GSPT2 (G1 To S Phase Transition 2 (GSPT2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GSPT2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GSPT2 antibody was raised against the N terminal of GSPT2

Purification: Affinity purified

Immunogen: GSPT2 antibody was raised using the N terminal of GSPT2 corresponding to a region with amino acids MALEESWEHSKEVSEAEPGGGSSGDSGPPEESGQEMMEEKEEIRKSKSVI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GSPT2 Blocking Peptide, catalog no. 33R-5685, is also available for use as a blocking control in assays to test for specificity of this GSPT2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSPT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GSPT2

Target: GSPT2 (G1 To S Phase Transition 2 (GSPT2))

Alternative Name: GSPT2 (GSPT2 Products)

Synonyms: ERF3B antibody, GST2 antibody, G1 to S phase transition 2 antibody, GSPT2 antibody, Gspt2 antibody

Background: GSPT2 is closely related to GSPT1, a GTP-binding protein that plays an essential role at the G1- to S-phase transition of the cell cycle in yeast and human cells. GSPT1 is a positive regulator of translational accuracy and, in a binary complex with eRF1, functions as a polypeptide chain release factor.GSPT2 is closely related to GSPT1, a GTP-binding protein that plays an essential role at the G1- to S-phase transition of the cell cycle in yeast and human cells.

Molecular Weight: 69 kDa (MW of target protein)