RMI1 antibody

Catalog No. ABIN634128

Product Details anti-RMI1 Antibody

Target: RMI1 (Homolog of Yeast RecQ-mediated Genome Instability 1 (RMI1))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RMI1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: RMI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids DGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVTAEA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RMI1 Blocking Peptide, catalog no. 33R-1953, is also available for use as a blocking control in assays to test for specificity of this RMI1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RMI1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RMI1

Target: RMI1 (Homolog of Yeast RecQ-mediated Genome Instability 1 (RMI1))

Alternative Name: RMI1 (RMI1 Products)

Background: RMI1 is an essential component of the RMI complex, a complex that plays an important role in the processing of homologous recombination intermediates to limit DNA crossover formation in cells. RMI1 promotes TOP3A binding to double Holliday junctions (DHJ) and hence stimulates TOP3A-mediated dissolution. RMI1 is required for BLM phosphorylation during mitosis. Within the BLM complex, RMI1 is required for BLM and TOP3A stability.

Molecular Weight: 70 kDa (MW of target protein)

Pathways: DNA Damage Repair