MCM9 antibody (N-Term)
-
- Target See all MCM9 Antibodies
- MCM9 (Minichromosome Maintenance Deficient 9 (MCM9))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MCM9 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MCM9 antibody was raised against the N terminal of MCM9
- Purification
- Affinity purified
- Immunogen
- MCM9 antibody was raised using the N terminal of MCM9 corresponding to a region with amino acids NSDQVTLVGQVFESYVSEYHKNDILLILKERDEDAHYPVVVNAMTLFETN
- Top Product
- Discover our top product MCM9 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MCM9 Blocking Peptide, catalog no. 33R-6870, is also available for use as a blocking control in assays to test for specificity of this MCM9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCM9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MCM9 (Minichromosome Maintenance Deficient 9 (MCM9))
- Alternative Name
- MCM9 (MCM9 Products)
- Synonyms
- C6orf61 antibody, MCMDC1 antibody, dJ329L24.1 antibody, dJ329L24.3 antibody, 9030408O17Rik antibody, Gm235 antibody, Mcmdc1 antibody, RGD1560557 antibody, mcm9 antibody, minichromosome maintenance 9 homologous recombination repair factor antibody, minichromosome maintenance 9 homologous recombination repair factor L homeolog antibody, MCM9 antibody, Mcm9 antibody, mcm9.L antibody
- Background
- MCM9 is a protein that shares similarity with minichromosome maintenance (MCM) proteins, which are known to be essential for initiation of DNA replication.
- Molecular Weight
- 44 kDa (MW of target protein)
-