MCM8 antibody (N-Term)

Catalog No. ABIN634124

Product Details anti-MCM8 Antibody

Target: MCM8 (Minichromosome Maintenance Deficient 8 (MCM8))

Binding Specificity: N-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MCM8 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MCM8 antibody was raised against the N terminal of MCM8

Purification: Affinity purified

Immunogen: MCM8 antibody was raised using the N terminal of MCM8 corresponding to a region with amino acids ELRDAPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSNDGETMVNVPH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MCM8 Blocking Peptide, catalog no. 33R-2568, is also available for use as a blocking control in assays to test for specificity of this MCM8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCM8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MCM8

Target: MCM8 (Minichromosome Maintenance Deficient 8 (MCM8))

Alternative Name: MCM8 (MCM8 Products)

Synonyms: C20orf154 antibody, dJ967N21.5 antibody, 5730432L01Rik antibody, minichromosome maintenance 8 homologous recombination repair factor antibody, minichromosome maintenance 8 homologous recombination repair factor L homeolog antibody, MCM8 antibody, Mcm8 antibody, mcm8.L antibody

Background: This protein is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein contains the central domain that is conserved among the MCM proteins. This protein has been shown to co-immunoprecipitate with MCM4, 6 and 7, which suggests that it may interact with other MCM proteins and play a role in DNA replication.

Molecular Weight: 94 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA