KIF22 antibody (N-Term)
-
- Target See all KIF22 Antibodies
- KIF22 (Kinesin Family Member 22 (KIF22))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KIF22 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KIF22 antibody was raised against the N terminal of KIF22
- Purification
- Affinity purified
- Immunogen
- KIF22 antibody was raised using the N terminal of KIF22 corresponding to a region with amino acids CSLEIANWRNHQETLKYQFDAFYGERSTQQDIYAGSVQPILRHLLEGQNA
- Top Product
- Discover our top product KIF22 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KIF22 Blocking Peptide, catalog no. 33R-1809, is also available for use as a blocking control in assays to test for specificity of this KIF22 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF22 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KIF22 (Kinesin Family Member 22 (KIF22))
- Alternative Name
- KIF22 (KIF22 Products)
- Background
- KIF22 a member of kinesin-like protein family. This family of proteins are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. The C-terminal half of this protein has been shown to bind DNA. Studies with the Xenopus homolog suggests its essential role in metaphase chromosome alignment and maintenance.
- Molecular Weight
- 73 kDa (MW of target protein)
-