KIF23 antibody (N-Term)

Catalog No. ABIN634117

Product Details anti-KIF23 Antibody

Target: KIF23 (Kinesin Family Member 23 (KIF23))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KIF23 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KIF23 antibody was raised against the N terminal of KIF23

Purification: Affinity purified

Immunogen: KIF23 antibody was raised using the N terminal of KIF23 corresponding to a region with amino acids VRPLGFPDQECCIEVINNTTVQLHTPEGYRLNRNGDYKETQYSFKQVFGT

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KIF23 Blocking Peptide, catalog no. 33R-9781, is also available for use as a blocking control in assays to test for specificity of this KIF23 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF23 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KIF23

Target: KIF23 (Kinesin Family Member 23 (KIF23))

Alternative Name: KIF23 (KIF23 Products)

Synonyms: KIF23 antibody, CHO1 antibody, KNSL5 antibody, MKLP-1 antibody, MKLP1 antibody, 3110001D19Rik antibody, C87313 antibody, Knsl5 antibody, cb738 antibody, knsl5 antibody, mklp1 antibody, wu:fi30e02 antibody, wu:fi39f08 antibody, zMKLP1 antibody, cho1 antibody, mklp-1 antibody, kinesin family member 23 antibody, kinesin family member 23 S homeolog antibody, KIF23 antibody, kif23 antibody, Kif23 antibody, kif23.S antibody

Background: KIF23 is a member of kinesin-like protein family. This family includes microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. This protein has been shown to cross-bridge antiparallel microtubules and drive microtubule movement in vitro. Alternate splicing of this gene results in two transcript variants encoding two different isoforms.

Molecular Weight: 98 kDa (MW of target protein)