CDT1 antibody (C-Term)

Catalog No. ABIN634110

Product Details anti-CDT1 Antibody

Target: CDT1 (Chromatin Licensing and DNA Replication Factor 1 (CDT1))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CDT1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CDT1 antibody was raised against the C terminal of CDT1

Purification: Affinity purified

Immunogen: CDT1 antibody was raised using the C terminal of CDT1 corresponding to a region with amino acids PATPPATPPAASPSALKGVSQDLLERIRAKEAQKQLAQMTRCPEQEQRLQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CDT1 Blocking Peptide, catalog no. 33R-6985, is also available for use as a blocking control in assays to test for specificity of this CDT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CDT1

Target: CDT1 (Chromatin Licensing and DNA Replication Factor 1 (CDT1))

Alternative Name: CDT1 (CDT1 Products)

Synonyms: CDT1 antibody, fc37h07 antibody, im:7158083 antibody, wu:fc37h07 antibody, wu:fi38h09 antibody, xcdt1 antibody, DUP antibody, RIS2 antibody, 2610318F11Rik antibody, AW545653 antibody, C76791 antibody, Ris2 antibody, dup antibody, ris2 antibody, chromatin licensing and DNA replication factor 1 antibody, chromatin licensing and DNA replication factor 1 L homeolog antibody, CDT1 antibody, cdt1 antibody, Cdt1 antibody, cdt1.L antibody

Background: CDT1 cooperates with CDC6 to promote the loading of the mini-chromosome maintenance complex onto chromatin to form the pre-replication complex necessary to initiate DNA replication.

Molecular Weight: 60 kDa (MW of target protein)

Pathways: MAPK Signaling, Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA