HECA antibody
-
- Target See all HECA Antibodies
- HECA (Headcase Homolog (HECA))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HECA antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- HECA antibody was raised using a synthetic peptide corresponding to a region with amino acids HKLNTFHVRMEDDAQVGQGEDLRKFILAALSASHRNVVNCALCHRALPVF
- Top Product
- Discover our top product HECA Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HECA Blocking Peptide, catalog no. 33R-3766, is also available for use as a blocking control in assays to test for specificity of this HECA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HECA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HECA (Headcase Homolog (HECA))
- Alternative Name
- HECA (HECA Products)
- Synonyms
- HECA antibody, si:dkey-34f16.2 antibody, HDC antibody, HDCL antibody, HHDC antibody, dJ225E12.1 antibody, Gm869 antibody, hdc homolog, cell cycle regulator antibody, Heca antibody, HECA antibody, heca antibody
- Background
- This gene encodes the homolog of the Drosophila headcase protein, a highly basic, cytoplasmic protein that regulates the re-entry of imaginal cells into the mitotic cycle during adult morphogenesis.
- Molecular Weight
- 59 kDa (MW of target protein)
-