KIF1A antibody (N-Term)
-
- Target See all KIF1A Antibodies
- KIF1A (Kinesin Family Member 1A (KIF1A))
-
Binding Specificity
- N-Term
-
Reactivity
- Mouse, Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KIF1A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KIF1 A antibody was raised against the N terminal of KIF1
- Purification
- Affinity purified
- Immunogen
- KIF1 A antibody was raised using the N terminal of KIF1 corresponding to a region with amino acids TTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQH
- Top Product
- Discover our top product KIF1A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KIF1A Blocking Peptide, catalog no. 33R-9321, is also available for use as a blocking control in assays to test for specificity of this KIF1A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KIF1A (Kinesin Family Member 1A (KIF1A))
- Alternative Name
- KIF1A (KIF1A Products)
- Background
- The protein encoded by this gene is a member of the kinesin family. This protein is highly similar to mouse heavy chain kinesin member 1A protein which is an anterograde motor protein that transports membranous organelles along axonal microtubules. It is thought that this protein may play a critical role in the development of axonal neuropathies resulting from impaired axonal transport.
- Molecular Weight
- 191 kDa (MW of target protein)
-