KIF2A antibody (C-Term)
-
- Target See all KIF2A Antibodies
- KIF2A (Kinesin Heavy Chain Member 2A (KIF2A))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KIF2A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KIF2 A antibody was raised against the C terminal of KIF2
- Purification
- Affinity purified
- Immunogen
- KIF2 A antibody was raised using the C terminal of KIF2 corresponding to a region with amino acids ETQWGVGSSPQRDDLKLLCEQNEEEVSPQLFTFHEAVSQMVEMEEQVVED
- Top Product
- Discover our top product KIF2A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KIF2A Blocking Peptide, catalog no. 33R-2768, is also available for use as a blocking control in assays to test for specificity of this KIF2A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KIF2A (Kinesin Heavy Chain Member 2A (KIF2A))
- Alternative Name
- KIF2A (KIF2A Products)
- Synonyms
- HK2 antibody, KIF2 antibody, C530030B14Rik antibody, Kif2 antibody, Kns2 antibody, M-kinesin antibody, kif2-a antibody, fj55b02 antibody, wu:fj55b02 antibody, kinesin family member 2A antibody, kinesin heavy chain member 2A L homeolog antibody, kinesin heavy chain member 2A antibody, zgc:103670 antibody, Kinesin-2 antibody, KIF2A antibody, Kif2a antibody, kif2a.L antibody, zgc:103670 antibody, GL50803_17333 antibody, GL50803_16456 antibody
- Background
- KIF2A belongs to the kinesin-like protein family, MCAK/KIF2 subfamily. It contains 1 kinesin-motor domain. KIF2A plus end-directed microtubule-dependent motor required for normal brain development. It may regulate microtubule dynamics during axonal growth. KIF2A is implicated in formation of bipolar mitotic spindles. It has microtubule depolymerization activity. Hela cells lacking KIF2A show asymmetric or monopolar mitotic spindles. Osteosarcoma cells (U2OS) lacking KIF2A or KIF2B show disorganised or monopolar mitotic spindles.
- Molecular Weight
- 80 kDa (MW of target protein)
- Pathways
- Microtubule Dynamics, Ribonucleoprotein Complex Subunit Organization
-