NPM2 antibody (N-Term)

Catalog No. ABIN634104

Product Details anti-NPM2 Antibody

Target: NPM2 (Nucleophosmin/nucleoplasmin 2 (NPM2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NPM2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NPM2 antibody was raised against the N terminal of NPM2

Purification: Affinity purified

Immunogen: NPM2 antibody was raised using the N terminal of NPM2 corresponding to a region with amino acids LEGKQSCRLLLHTICLGEKAKEEMHRVEILPPANQEDKKMQPVTIASLQA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NPM2 Blocking Peptide, catalog no. 33R-4898, is also available for use as a blocking control in assays to test for specificity of this NPM2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NPM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NPM2

Target: NPM2 (Nucleophosmin/nucleoplasmin 2 (NPM2))

Alternative Name: NPM2 (NPM2 Products)

Synonyms: nucleophosmin/nucleoplasmin 2 antibody, Npm2 antibody, NPM2 antibody

Background: NPM2 belongs to the nucleoplasmin family. It probably involved in sperm DNA decondensation during fertilization.

Molecular Weight: 24 kDa (MW of target protein)