RFC5 antibody

Catalog No. ABIN634103

Product Details anti-RFC5 Antibody

Target: RFC5 (Replication Factor C (Activator 1) 5, 36.5kDa (RFC5))

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RFC5 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogen: RFC5 antibody was raised using a synthetic peptide corresponding to a region with amino acids METSALKQQEQPAATKIRNLPWVEKYRPQTLNDLISHQDILSTIQKFINE

Application Details

Application Notes: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RFC5 Blocking Peptide, catalog no. 33R-5977, is also available for use as a blocking control in assays to test for specificity of this RFC5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RFC5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RFC5

Target: RFC5 (Replication Factor C (Activator 1) 5, 36.5kDa (RFC5))

Alternative Name: RFC5 (RFC5 Products)

Synonyms: zgc:110313 antibody, 2610020K06Rik antibody, 2610209F07Rik antibody, 36.5kDa antibody, 36kDa antibody, Recc5 antibody, RFC36 antibody, replication factor C (activator 1) 5 antibody, replication factor C subunit 5 antibody, replication factor C subunit 5 L homeolog antibody, rfc5 antibody, Rfc5 antibody, RFC5 antibody, rfc5.L antibody

Background: The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kDa. RFC5 is the 36 kDa subunit. This subunit can interact with the C-terminal region of PCNA. It forms a core complex with the 38 and 40 kDa subunits. The core complex possesses DNA-dependent ATPase activity, which was found to be stimulated by PCNA in an in vitro system.

Molecular Weight: 38 kDa (MW of target protein)

Pathways: Telomere Maintenance, DNA Damage Repair, DNA Replication, Synthesis of DNA