RAN antibody (Middle Region)

Catalog No. ABIN634102

Product Details anti-RAN Antibody

Target: RAN (RAN, Member RAS Oncogene Family (RAN))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat, Dog, Drosophila melanogaster, C. elegans

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAN antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Ran antibody was raised against the middle region of RAN

Purification: Affinity purified

Immunogen: Ran antibody was raised using the middle region of RAN corresponding to a region with amino acids NLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Ran Blocking Peptide, catalog no. 33R-6771, is also available for use as a blocking control in assays to test for specificity of this Ran antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAN

Target: RAN (RAN, Member RAS Oncogene Family (RAN))

Alternative Name: Ran (RAN Products)

Synonyms: ARA24 antibody, Gsp1 antibody, TC4 antibody, ran antibody, ara24 antibody, gsp1 antibody, ran-1 antibody, tc4 antibody, RAN antibody, RANP1 antibody, AAF30287 antibody, CG1404 antibody, Dmel\CG1404 antibody, Ran antibody, dran antibody, l(1)G0075 antibody, ran10A antibody, fc16b04 antibody, wu:fc16b04 antibody, RAN, member RAS oncogene family antibody, RAN, member RAS oncogene family S homeolog antibody, CG1404 gene product from transcript CG1404-RC antibody, RAN antibody, Ran antibody, ran.S antibody, ran antibody

Background: RAN (ras-related nuclear protein) is a small GTP binding protein belonging to the RAS superfamily that is essential for the translocation of RNA and proteins through the nuclear pore complex.

Molecular Weight: 24 kDa (MW of target protein)

Pathways: Regulatory RNA Pathways, Intracellular Steroid Hormone Receptor Signaling Pathway, Protein targeting to Nucleus