NCAPH antibody (N-Term)

Catalog No. ABIN634092

Product Details anti-NCAPH Antibody

Target: NCAPH (Non-SMC Condensin I Complex, Subunit H (NCAPH))

Binding Specificity: N-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NCAPH antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NCAPH antibody was raised against the N terminal of NCAPH

Purification: Affinity purified

Immunogen: NCAPH antibody was raised using the N terminal of NCAPH corresponding to a region with amino acids MPLPRKAPLNIPGTPVLEDFPQNDDEKERLQRRRSRVFDLQFSTDSPRLL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NCAPH Blocking Peptide, catalog no. 33R-6292, is also available for use as a blocking control in assays to test for specificity of this NCAPH antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NCAPH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NCAPH

Target: NCAPH (Non-SMC Condensin I Complex, Subunit H (NCAPH))

Alternative Name: NCAPH (NCAPH Products)

Synonyms: NCAPH antibody, si:dkeyp-86b9.4 antibody, zgc:158618 antibody, BRRN1 antibody, CAP-H antibody, brrn1 antibody, cap-h antibody, A730011O11Rik antibody, Brrn1 antibody, HCAP-H antibody, mKIAA0074 antibody, non-SMC condensin I complex subunit H antibody, non-SMC condensin I complex, subunit H antibody, condensin complex subunit 2 antibody, non-SMC condensin I complex subunit H S homeolog antibody, NCAPH antibody, ncaph antibody, LOC708975 antibody, ncaph.S antibody, Ncaph antibody

Background: NCAPH is a member of the barr family and a regulatory subunit of the condensin complex. This complex is required for the conversion of interphase chromatin into condensed chromosomes. The protein is associated with mitotic chromosomes, except during the early phase of chromosome condensation. During interphase, the protein has a distinct punctate nucleolar localization.

Molecular Weight: 82 kDa (MW of target protein)