MCM3 antibody (C-Term)
-
- Target See all MCM3 Antibodies
- MCM3 (Minichromosome Maintenance Complex Component 3 (MCM3))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MCM3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MCM3 antibody was raised against the C terminal of MCM3
- Purification
- Affinity purified
- Immunogen
- MCM3 antibody was raised using the C terminal of MCM3 corresponding to a region with amino acids YAYFKKVLEKEKKRKKRSEDESETEDEEEKSQEDQEQKRKRRKTRQPDAK
- Top Product
- Discover our top product MCM3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MCM3 Blocking Peptide, catalog no. 33R-10056, is also available for use as a blocking control in assays to test for specificity of this MCM3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCM3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MCM3 (Minichromosome Maintenance Complex Component 3 (MCM3))
- Alternative Name
- MCM3 (MCM3 Products)
- Synonyms
- HCC5 antibody, P1-MCM3 antibody, P1.h antibody, RLFB antibody, AL033361 antibody, C80350 antibody, Mcmd antibody, P1 antibody, p1.m antibody, cb32 antibody, chunp6867 antibody, wu:fa26g03 antibody, CG4206 antibody, DmMCM3 antibody, DmMcm3 antibody, DmeMCM3 antibody, Dmel\\CG4206 antibody, MCM3 antibody, McM3 antibody, Mcp-PCR2 antibody, PCR2 antibody, dMCM3 antibody, xmcm3 antibody, minichromosome maintenance complex component 3 antibody, MCM3 minichromosome maintenance deficient 3 (S. cerevisiae) antibody, Minichromosome maintenance 3 antibody, minichromosome maintenance complex component 3 L homeolog antibody, MCM complex subunit Mcm3 antibody, MCM3 antibody, mcm3 antibody, Mcm3 antibody, mcm3.L antibody
- Background
- MCM3 is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with, and thus is acetlyated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression.
- Molecular Weight
- 91 kDa (MW of target protein)
- Pathways
- DNA Damage Repair, Mitotic G1-G1/S Phases, DNA Replication, Chromatin Binding, Synthesis of DNA
-