RFC3 antibody

Catalog No. ABIN634080

Product Details anti-RFC3 Antibody

Target: RFC3 (Replication Factor C (Activator 1) 3, 38kDa (RFC3))

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RFC3 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: RFC3 antibody was raised using a synthetic peptide corresponding to a region with amino acids YHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETNSQRDFKVVLLTEVDKL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RFC3 Blocking Peptide, catalog no. 33R-10126, is also available for use as a blocking control in assays to test for specificity of this RFC3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RFC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RFC3

Target: RFC3 (Replication Factor C (Activator 1) 3, 38kDa (RFC3))

Alternative Name: RFC3 (RFC3 Products)

Background: The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kDa. RFC3 is the 38 kDa subunit. This subunit is essential for the interaction between the 140 kDa subunit and the core complex that consists of the 36, 37, and 40 kDa subunits.

Molecular Weight: 40 kDa (MW of target protein)

Pathways: Telomere Maintenance, DNA Damage Repair, DNA Replication, Synthesis of DNA