Cyclin Y antibody (Middle Region)
-
- Target See all Cyclin Y (CCNY) Antibodies
- Cyclin Y (CCNY)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Cyclin Y antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Cyclin Y antibody was raised against the middle region of CCNY
- Purification
- Affinity purified
- Immunogen
- Cyclin Y antibody was raised using the middle region of CCNY corresponding to a region with amino acids DENLHPLSKSEVPPDYDKHNPEQKQIYRFVRTLFSAAQLTAECAIVTLVY
- Top Product
- Discover our top product CCNY Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Cyclin Y Blocking Peptide, catalog no. 33R-1914, is also available for use as a blocking control in assays to test for specificity of this Cyclin Y antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCNY antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Cyclin Y (CCNY)
- Alternative Name
- Cyclin Y (CCNY Products)
- Synonyms
- CG14939 antibody, Dcyclin Y antibody, Dmel\\CG14939 antibody, anon-WO0118547.165 antibody, i182 antibody, C10orf9 antibody, CBCP1 antibody, CCNX antibody, CFP1 antibody, 1700025H17Rik antibody, 3110050L10Rik antibody, 4631402G10Rik antibody, 5730405I09Rik antibody, RGD1565969 antibody, cyclin Y antibody, Cyclin Y antibody, cyclin Y like 1 antibody, CCNY antibody, CycY antibody, Ccny antibody, CCNYL1 antibody
- Background
- CCNY belongs to the cyclin family, Cyclin Y subfamily. It contains 1 cyclin N-terminal domain. Single nucleotide polymorphism in CCNY gene is associated with Crohn's disease and ulcerative colitis.
- Molecular Weight
- 39 kDa (MW of target protein)
-