GTSE1 antibody (N-Term)

Catalog No. ABIN634069

Product Details anti-GTSE1 Antibody

Target: GTSE1 (G-2 and S-Phase Expressed 1 (GTSE1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GTSE1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GTSE1 antibody was raised against the N terminal of GTSE1

Purification: Affinity purified

Immunogen: GTSE1 antibody was raised using the N terminal of GTSE1 corresponding to a region with amino acids NNPVPEQPPLPTSESPFAWSPLAGEKFVEVYKEAHLLALHIESSSRNQAA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GTSE1 Blocking Peptide, catalog no. 33R-6810, is also available for use as a blocking control in assays to test for specificity of this GTSE1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GTSE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GTSE1

Target: GTSE1 (G-2 and S-Phase Expressed 1 (GTSE1))

Alternative Name: GTSE1 (GTSE1 Products)

Synonyms: gtse1 antibody, MGC81588 antibody, MGC89498 antibody, GTSE1 antibody, fb70b04 antibody, fj88g09 antibody, wu:fb70b04 antibody, wu:fj88g09 antibody, wu:fy65d12 antibody, MGC114722 antibody, B99 antibody, Gtse-1 antibody, RGD1563164 antibody, G2 and S-phase expressed 1 S homeolog antibody, G2 and S-phase expressed 1 antibody, G-2 and S-phase expressed 1 antibody, G2 and S-phase expressed 1 L homeolog antibody, G two S phase expressed protein 1 antibody, gtse1.S antibody, gtse1 antibody, GTSE1 antibody, gtse1.L antibody, Gtse1 antibody

Background: GTSE1 is only expressed in the S and G2 phases of the cell cycle, where it colocalizes with cytoplasmic tubulin and microtubules. In response to DNA damage, the encoded protein accumulates in the nucleus and binds the tumor suppressor protein p53, shuttling it out of the nucleus and repressing its ability to induce apoptosis.

Molecular Weight: 76 kDa (MW of target protein)