RDH16 antibody
-
- Target See all RDH16 Antibodies
- RDH16 (Retinol Dehydrogenase 16 (All-Trans) (RDH16))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RDH16 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- RDH16 antibody was raised using a synthetic peptide corresponding to a region with amino acids WLYLAVFVGLYYLLHWYRERQVLSHLRDKYVFITGCDSGFGKLLARQLDA
- Top Product
- Discover our top product RDH16 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RDH16 Blocking Peptide, catalog no. 33R-9976, is also available for use as a blocking control in assays to test for specificity of this RDH16 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RDH16 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RDH16 (Retinol Dehydrogenase 16 (All-Trans) (RDH16))
- Alternative Name
- RDH16 (RDH16 Products)
- Synonyms
- MGC68820 antibody, CRAD antibody, CRAD1 antibody, Rdh6 antibody, RODH-4 antibody, SDR9C8 antibody, Rdh2 antibody, RoDHII antibody, retinol dehydrogenase 16 (all-trans) L homeolog antibody, retinol dehydrogenase 16 (all-trans) antibody, retinol dehydrogenase 16 antibody, rdh16.L antibody, RDH16 antibody, rdh16 antibody, Rdh16 antibody
- Background
- RDH16 is an oxidoreductase with a preference for NAD. It oxidizes all-trans-retinol and 13-cis-retinol to the corresponding aldehydes. RDH16 has higher activity towards CRBP-bound retinol than with free retinol. It also oxidizes androstanediol and androsterone to dihydrotestosterone and androstanedione. RDH16 can also catalyze the reverse reaction.
- Molecular Weight
- 36 kDa (MW of target protein)
- Pathways
- Steroid Hormone Biosynthesis
-