POFUT2 antibody (N-Term)

Catalog No. ABIN634059

Product Details anti-POFUT2 Antibody

Target: POFUT2 (Protein O-Fucosyltransferase 2 (POFUT2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This POFUT2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: POFUT2 antibody was raised against the N terminal of POFUT2

Purification: Affinity purified

Immunogen: POFUT2 antibody was raised using the N terminal of POFUT2 corresponding to a region with amino acids GAASRRRYLLYDVNPPEGFNLRRDVYIRIASLLKTLLKTEEWVLVLPPWG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

POFUT2 Blocking Peptide, catalog no. 33R-3149, is also available for use as a blocking control in assays to test for specificity of this POFUT2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POFUT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for POFUT2

Target: POFUT2 (Protein O-Fucosyltransferase 2 (POFUT2))

Alternative Name: POFUT2 (POFUT2 Products)

Synonyms: C21orf80 antibody, FUT13 antibody, fc46a11 antibody, wu:fc46a11 antibody, zgc:194822 antibody, 2310011G23Rik antibody, AI256847 antibody, BC003494 antibody, protein O-fucosyltransferase 2 antibody, POFUT2 antibody, pofut2 antibody, Pofut2 antibody

Background: POFUT2 catalyzes the reaction that attaches fucose through an O-glycosidic linkage to a conserved serine or threonine residue in thrombospondin type 1 repeats. Fucose is typically found as a terminal modification of branched chain glycoconjugates, but it also exists in direct O-linkage to serine or threonine residues within cystine knot motifs in epidermal growth factor-like repeats or thrombospondin.

Molecular Weight: 50 kDa (MW of target protein)