LCN12 antibody (N-Term)
-
- Target See all LCN12 Antibodies
- LCN12 (Lipocalin 12 (LCN12))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LCN12 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Lipocalin 12 antibody was raised against the N terminal of LCN12
- Purification
- Affinity purified
- Immunogen
- Lipocalin 12 antibody was raised using the N terminal of LCN12 corresponding to a region with amino acids GNQFQGEWFVLGLAGNSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRG
- Top Product
- Discover our top product LCN12 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Lipocalin 12 Blocking Peptide, catalog no. 33R-3454, is also available for use as a blocking control in assays to test for specificity of this Lipocalin 12 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LCN12 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LCN12 (Lipocalin 12 (LCN12))
- Alternative Name
- Lipocalin 12 (LCN12 Products)
- Synonyms
- 9230102M18Rik antibody, lipocalin 12 antibody, LCN12 antibody, Lcn12 antibody
- Background
- LCN12 may play a role in male fertility. LCN12 may act as a retinoid carrier protein within the epididymis.
- Molecular Weight
- 39 kDa (MW of target protein)
-