RANGAP1 antibody (N-Term)

Catalog No. ABIN634052

Product Details anti-RANGAP1 Antibody

Target: RANGAP1 (Ran GTPase Activating Protein 1 (RANGAP1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RANGAP1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RanGAP1 antibody was raised against the N terminal of RANGAP1

Purification: Affinity purified

Immunogen: RanGAP1 antibody was raised using the N terminal of RANGAP1 corresponding to a region with amino acids MASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RanGAP1 Blocking Peptide, catalog no. 33R-5742, is also available for use as a blocking control in assays to test for specificity of this RanGAP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RANGAP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RANGAP1

Target: RANGAP1 (Ran GTPase Activating Protein 1 (RANGAP1))

Alternative Name: RanGAP1 (RANGAP1 Products)

Synonyms: Fug1 antibody, RANGAP antibody, SD antibody, ATRANGAP1 antibody, RAN GTPASE-ACTIVATING PROTEIN 1 antibody, RAN GTPase activating protein 1 antibody, RanGAP1 antibody, fug1 antibody, rangap1b antibody, rna1p antibody, C79654 antibody, mKIAA1835 antibody, rangap1 antibody, rangap1a antibody, Protein rna1 antibody, CG9999 antibody, CT28175 antibody, Dmel\CG9999 antibody, RGP1_DROME antibody, Ran antibody, RanGAP antibody, RanGap antibody, RanGap1 antibody, Scl antibody, Sd antibody, Sd-RanGAP antibody, Sd-RanGap antibody, dRanGAP antibody, ranGAP antibody, ranGap antibody, rangap antibody, zgc:154097 antibody, Ran GTPase activating protein 1 antibody, RAN GTPase activating protein 1 antibody, ran GTPase activating protein 1 antibody, Ran GTPase activating protein 1 S homeolog antibody, Ran GTPase activating protein 1 L homeolog antibody, Ran GAP Rna1 antibody, Ran GTPase activating protein antibody, RAN GTPase activating protein 1a antibody, RANGAP1 antibody, TERG_02084 antibody, rangap1.S antibody, Rangap1 antibody, rangap1.L antibody, rna1 antibody, RanGAP antibody, rangap1a antibody

Background: RanGAP1, is a homodimeric 65 kDa polypeptide that specifically induces the GTPase activity of RAN, but not of RAS by over 1,000-fold. RanGAP1 is the immediate antagonist of RCC1, a regulator molecule that keeps RAN in the active, GTP-bound state.

Molecular Weight: 63 kDa (MW of target protein)

Pathways: M Phase, Protein targeting to Nucleus