DHRS9 antibody
-
- Target See all DHRS9 Antibodies
- DHRS9 (Dehydrogenase/reductase (SDR Family) Member 9 (DHRS9))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DHRS9 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- DHRS9 antibody was raised using a synthetic peptide corresponding to a region with amino acids DPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPV
- Top Product
- Discover our top product DHRS9 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DHRS9 Blocking Peptide, catalog no. 33R-2120, is also available for use as a blocking control in assays to test for specificity of this DHRS9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHRS9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DHRS9 (Dehydrogenase/reductase (SDR Family) Member 9 (DHRS9))
- Alternative Name
- DHRS9 (DHRS9 Products)
- Synonyms
- 3ALPHA-HSD antibody, RDH-TBE antibody, RDH15 antibody, RDHL antibody, RDHTBE antibody, RETSDR8 antibody, SDR9C4 antibody, Rdhl antibody, C730025I08Rik antibody, Rdh15 antibody, rdhl antibody, 3alpha-hsd antibody, rdh15 antibody, retsdr8 antibody, DHRS9 antibody, RDHA antibody, rdh1l antibody, wu:fb64b07 antibody, zgc:73286 antibody, dehydrogenase/reductase 9 antibody, dehydrogenase/reductase (SDR family) member 9 antibody, dehydrogenase/reductase (SDR family) member 9 L homeolog antibody, DHRS9 antibody, Dhrs9 antibody, dhrs9.L antibody, dhrs9 antibody
- Background
- DHRS9 is a 3-alpha-hydroxysteroid dehydrogenase that converts 3-alpha-tetrahydroprogesterone (allopregnanolone) to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone.
- Molecular Weight
- 35 kDa (MW of target protein)
- Pathways
- C21-Steroid Hormone Metabolic Process
-