CREG2 antibody (N-Term)

Catalog No. ABIN634048

Product Details anti-CREG2 Antibody

Target: CREG2 (Cellular Repressor of E1A-Stimulated Genes 2 (CREG2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CREG2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CREG2 antibody was raised against the N terminal of CREG2

Purification: Affinity purified

Immunogen: CREG2 antibody was raised using the N terminal of CREG2 corresponding to a region with amino acids VSSVSWAVTNEVDEELDSASTEEAMPALLEDSGSIWQQSFPASAHKEDAH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CREG2 Blocking Peptide, catalog no. 33R-9827, is also available for use as a blocking control in assays to test for specificity of this CREG2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CREG2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CREG2

Target: CREG2 (Cellular Repressor of E1A-Stimulated Genes 2 (CREG2))

Alternative Name: CREG2 (CREG2 Products)

Synonyms: zgc:92257 antibody, A830098L22Rik antibody, Creg2-ps1 antibody, RGD1564056 antibody, cellular repressor of E1A-stimulated genes 2 antibody, cellular repressor of E1A stimulated genes 2 antibody, creg2 antibody, CREG2 antibody, Creg2 antibody

Background: The function of CREG2 has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 32 kDa (MW of target protein)