BMPER antibody (C-Term)

Catalog No. ABIN634046

Product Details anti-BMPER Antibody

Target: BMPER (BMP Binding Endothelial Regulator (BMPER))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BMPER antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: BMPER antibody was raised against the C terminal of BMPER

Purification: Affinity purified

Immunogen: BMPER antibody was raised using the C terminal of BMPER corresponding to a region with amino acids NGHKRDDLIGGDGNFKFDVDDFAESWRVESNEFCNRPQRKPVPELCQGTV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BMPER Blocking Peptide, catalog no. 33R-6702, is also available for use as a blocking control in assays to test for specificity of this BMPER antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BMPER antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BMPER

Target: BMPER (BMP Binding Endothelial Regulator (BMPER))

Alternative Name: BMPER (BMPER Products)

Synonyms: BMPER antibody, CG15671 antibody, CT35855 antibody, Cv 2 antibody, Cv-2 antibody, Cv2 antibody, Dmel\\CG15671 antibody, cv 2 antibody, CV2 antibody, cv-2 antibody, crim3 antibody, cv2 antibody, cvl2 antibody, id:ibd5071 antibody, CV-2 antibody, CRIM3 antibody, 3110056H04Rik antibody, Crim3 antibody, RGD1563373 antibody, BMP binding endothelial regulator antibody, crossveinless 2 antibody, BMP-binding endothelial regulator protein antibody, BMP binding endothelial regulator L homeolog antibody, BMP-binding endothelial regulator antibody, BMPER antibody, cv-2 antibody, bmper antibody, LOC100070275 antibody, cv2 antibody, bmper.L antibody, Bmper antibody

Background: BMPER contains 1 TIL (trypsin inhibitory-like) domain, 5 VWFC domains and 1 VWFD domain.BMPER is the inhibitor of bone morphogenetic protein (BMP) functions. It may regulate BMP responsiveness of osteoblasts and chondrocytes.

Molecular Weight: 76 kDa (MW of target protein)