CES5A antibody (N-Term)

Catalog No. ABIN634041

Product Details anti-CES5A Antibody

Target: CES5A (Carboxylesterase 5A (CES5A))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CES5A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Carboxylesterase 7 antibody was raised against the N terminal of CES7

Purification: Affinity purified

Immunogen: Carboxylesterase 7 antibody was raised using the N terminal of CES7 corresponding to a region with amino acids SGNWVHPGQILIWAIWVLAAPTKGPSAEGPQRNTRLGWIQGKQVTVLGSP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Carboxylesterase 7 Blocking Peptide, catalog no. 33R-8476, is also available for use as a blocking control in assays to test for specificity of this Carboxylesterase 7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CES7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CES5A

Target: CES5A (Carboxylesterase 5A (CES5A))

Alternative Name: Carboxylesterase 7 (CES5A Products)

Synonyms: CAUXIN antibody, CES4C1 antibody, CES5 antibody, CES7 antibody, 1700081L16Rik antibody, 1700122C07Rik antibody, BB081581 antibody, Ces7 antibody, Gm503 antibody, cauxin antibody, Ces5 antibody, LOC445455 antibody, carboxylesterase 5A antibody, CES5A antibody, Ces5a antibody

Background: CES7 belongs to the type-B carboxylesterase/lipase family. It is involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs.

Molecular Weight: 58 kDa (MW of target protein)