CPQ antibody (N-Term)

Catalog No. ABIN634040

Product Details anti-CPQ Antibody

Target: CPQ (Carboxypeptidase Q (CPQ))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CPQ antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PGCP antibody was raised against the N terminal of PGCP

Purification: Affinity purified

Immunogen: PGCP antibody was raised using the N terminal of PGCP corresponding to a region with amino acids VDTVGPRLSGSKNLEKAIQIMYQNLQQDGLEKVHLEPVRIPHWERGEESA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PGCP Blocking Peptide, catalog no. 33R-9484, is also available for use as a blocking control in assays to test for specificity of this PGCP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGCP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CPQ

Target: CPQ (Carboxypeptidase Q (CPQ))

Alternative Name: PGCP (CPQ Products)

Synonyms: LDP antibody, PGCP antibody, 1190003P12Rik antibody, 2610034C17Rik antibody, Hls2 antibody, Lal-1 antibody, Pgcp antibody, LAL antibody, lal-1 antibody, MGC80390 antibody, pgcp antibody, carboxypeptidase Q antibody, carboxypeptidase Q L homeolog antibody, CPQ antibody, Cpq antibody, cpq.L antibody

Background: PGCP is a carboxypeptidase that may play an important role in the hydrolysis of circulating peptides.

Molecular Weight: 52 kDa (MW of target protein)