FCN3 antibody (N-Term)

Catalog No. ABIN634029

Product Details anti-FCN3 Antibody

Target: FCN3 (Ficolin (Collagen/fibrinogen Domain Containing) 3 (Hakata Antigen) (FCN3))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FCN3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FCN3 antibody was raised against the N terminal of FCN3

Purification: Affinity purified

Immunogen: FCN3 antibody was raised using the N terminal of FCN3 corresponding to a region with amino acids LEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGDPVNLL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FCN3 Blocking Peptide, catalog no. 33R-4879, is also available for use as a blocking control in assays to test for specificity of this FCN3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FCN3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FCN3

Target: FCN3 (Ficolin (Collagen/fibrinogen Domain Containing) 3 (Hakata Antigen) (FCN3))

Alternative Name: FCN3 (FCN3 Products)

Synonyms: FCNH antibody, HAKA1 antibody, ficolin 3 antibody, ficolin-3 antibody, FCN3 antibody, Fcn3 antibody, fcn3-A antibody

Background: Ficolins are a group of proteins which consist of a collagen-like domain and a fibrinogen-like domain. In human serum, there are two types of ficolins, both of which have lectin activity.

Molecular Weight: 31 kDa (MW of target protein)

Pathways: Complement System