MFAP2 antibody (N-Term)

Catalog No. ABIN634025

Product Details anti-MFAP2 Antibody

Target: MFAP2 (Microfibrillar Associated Protein 2 (MFAP2))

Binding Specificity: N-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MFAP2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MFAP2 antibody was raised against the N terminal of MFAP2

Purification: Affinity purified

Immunogen: MFAP2 antibody was raised using the N terminal of MFAP2 corresponding to a region with amino acids MRAAYLFLLFLPAGLLAQGQYDLDPLPPFPDHVQYTHYSDQIDNPDYYDY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MFAP2 Blocking Peptide, catalog no. 33R-6351, is also available for use as a blocking control in assays to test for specificity of this MFAP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MFAP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MFAP2

Target: MFAP2 (Microfibrillar Associated Protein 2 (MFAP2))

Alternative Name: MFAP2 (MFAP2 Products)

Synonyms: MAGP antibody, MAGP-1 antibody, MAGP1 antibody, AI893631 antibody, Magp antibody, Magp1 antibody, microfibril associated protein 2 antibody, microfibrillar-associated protein 2 antibody, MFAP2 antibody, Mfap2 antibody

Background: Microfibrillar-associated protein 2 is a major antigen of elastin-associated microfibrils and a candidate for involvement in the etiology of inherited connective tissue diseases.

Molecular Weight: 19 kDa (MW of target protein)