MFAP2 antibody (N-Term)
-
- Target See all MFAP2 Antibodies
- MFAP2 (Microfibrillar Associated Protein 2 (MFAP2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MFAP2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MFAP2 antibody was raised against the N terminal of MFAP2
- Purification
- Affinity purified
- Immunogen
- MFAP2 antibody was raised using the N terminal of MFAP2 corresponding to a region with amino acids MRAAYLFLLFLPAGLLAQGQYDLDPLPPFPDHVQYTHYSDQIDNPDYYDY
- Top Product
- Discover our top product MFAP2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MFAP2 Blocking Peptide, catalog no. 33R-6351, is also available for use as a blocking control in assays to test for specificity of this MFAP2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MFAP2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MFAP2 (Microfibrillar Associated Protein 2 (MFAP2))
- Alternative Name
- MFAP2 (MFAP2 Products)
- Synonyms
- MAGP antibody, MAGP-1 antibody, MAGP1 antibody, AI893631 antibody, Magp antibody, Magp1 antibody, microfibril associated protein 2 antibody, microfibrillar-associated protein 2 antibody, MFAP2 antibody, Mfap2 antibody
- Background
- Microfibrillar-associated protein 2 is a major antigen of elastin-associated microfibrils and a candidate for involvement in the etiology of inherited connective tissue diseases.
- Molecular Weight
- 19 kDa (MW of target protein)
-