F13B antibody (Middle Region)

Catalog No. ABIN634019

Product Details anti-F13B Antibody

Target: F13B (Coagulation Factor 13, B Polypeptide (F13B))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This F13B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Factor XIII B Polypeptide antibody was raised against the middle region of F13 B

Purification: Affinity purified

Immunogen: Factor XIII B Polypeptide antibody was raised using the middle region of F13 B corresponding to a region with amino acids LRLIENGYFHPVKQTYEEGDVVQFFCHENYYLSGSDLIQCYNFGWYPESP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Factor XIII B Polypeptide Blocking Peptide, catalog no. 33R-5367, is also available for use as a blocking control in assays to test for specificity of this Factor XIII B Polypeptide antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of F10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for F13B

Target: F13B (Coagulation Factor 13, B Polypeptide (F13B))

Alternative Name: Factor XIII B Polypeptide (F13B Products)

Synonyms: F13B antibody, coagulation factor XIII B chain antibody, LOC100347263 antibody

Background: F13B contains 10 Sushi (CCP/SCR) domains. The B chain of factor XIII is not catalytically active, but is thought to stabilize the A subunits and regulate the rate of transglutaminase formation by thrombin. Defects in F13B can result in a lifelong bleeding tendency, defective wound healing, and habitual abortion.

Molecular Weight: 73 kDa (MW of target protein)