ZG16 antibody (Middle Region)
-
- Target See all ZG16 Antibodies
- ZG16 (Zymogen Granule Protein 16 (ZG16))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ZG16 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ZG16 antibody was raised against the middle region of ZG16
- Purification
- Affinity purified
- Immunogen
- ZG16 antibody was raised using the middle region of ZG16 corresponding to a region with amino acids WSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLVFVTDKGRYLSFG
- Top Product
- Discover our top product ZG16 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ZG16 Blocking Peptide, catalog no. 33R-10009, is also available for use as a blocking control in assays to test for specificity of this ZG16 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZG16 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ZG16 (Zymogen Granule Protein 16 (ZG16))
- Alternative Name
- ZG16 (ZG16 Products)
- Synonyms
- JCLN antibody, JCLN1 antibody, ZG16A antibody, Zg-16p antibody, Zg16p antibody, 1810010M01Rik antibody, AI593689 antibody, ZG16p antibody, zymogen granule protein 16 antibody, ZG16 antibody, Zg16 antibody
- Background
- ZG16 may act as a linker molecule between the submembranous matrix on the luminal side of zymogen granule membrane (ZGM) and aggregated secretory proteins during granule formation in the TGN.
- Molecular Weight
- 18 kDa (MW of target protein)
-