ZG16 antibody (Middle Region)

Catalog No. ABIN634014

Product Details anti-ZG16 Antibody

Target: ZG16 (Zymogen Granule Protein 16 (ZG16))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ZG16 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ZG16 antibody was raised against the middle region of ZG16

Purification: Affinity purified

Immunogen: ZG16 antibody was raised using the middle region of ZG16 corresponding to a region with amino acids WSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLVFVTDKGRYLSFG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ZG16 Blocking Peptide, catalog no. 33R-10009, is also available for use as a blocking control in assays to test for specificity of this ZG16 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZG16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ZG16

Target: ZG16 (Zymogen Granule Protein 16 (ZG16))

Alternative Name: ZG16 (ZG16 Products)

Synonyms: JCLN antibody, JCLN1 antibody, ZG16A antibody, Zg-16p antibody, Zg16p antibody, 1810010M01Rik antibody, AI593689 antibody, ZG16p antibody, zymogen granule protein 16 antibody, ZG16 antibody, Zg16 antibody

Background: ZG16 may act as a linker molecule between the submembranous matrix on the luminal side of zymogen granule membrane (ZGM) and aggregated secretory proteins during granule formation in the TGN.

Molecular Weight: 18 kDa (MW of target protein)