Chymotrypsin antibody (N-Term)

Catalog No. ABIN634009

Product Details anti-Chymotrypsin Antibody

Target: Chymotrypsin (CTRL)

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Chymotrypsin antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Chymotrypsin-Like antibody was raised against the N terminal of CTRL

Purification: Affinity purified

Immunogen: Chymotrypsin-Like antibody was raised using the N terminal of CTRL corresponding to a region with amino acids SQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNS

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Chymotrypsin-Like Blocking Peptide, catalog no. 33R-8727, is also available for use as a blocking control in assays to test for specificity of this Chymotrypsin-Like antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CTRL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Chymotrypsin

Target: Chymotrypsin (CTRL)

Alternative Name: Chymotrypsin-Like (CTRL Products)

Synonyms: 0910001G08Rik antibody, 1810004D15Rik antibody, AV005227 antibody, Ctra-1 antibody, Ctra1 antibody, chymopasin antibody, mFLJ00366 antibody, CTRL1 antibody, chymotrypsin-like antibody, chymotrypsin like antibody, Ctrl antibody, CTRL antibody

Target Type: Chemical

Background: CTRL possesses serine-type endopeptidase activity.

Molecular Weight: 28 kDa (MW of target protein)