IFNA7 antibody (N-Term)

Catalog No. ABIN634003

Product Details anti-IFNA7 Antibody

Target: IFNA7 (IFNa7) (Interferon, alpha 7 (IFNa7))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IFNA7 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: IFN Alpha 7 antibody was raised against the N terminal of IFNA7

Purification: Affinity purified

Immunogen: IFN Alpha 7 antibody was raised using the N terminal of IFNA7 corresponding to a region with amino acids RALILLAQMGRISPFSCLKDRHEFRFPEEEFDGHQFQKTQAISVLHEMIQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IFN Alpha 7 Blocking Peptide, catalog no. 33R-7815, is also available for use as a blocking control in assays to test for specificity of this IFN Alpha 7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFNA7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IFNA7

Target: IFNA7 (IFNa7) (Interferon, alpha 7 (IFNa7))

Alternative Name: IFN alpha 7 (IFNa7 Products)

Synonyms: CaIFN-alpha 7 antibody, Ifa7 antibody, IFN-alphaJ antibody, IFNA-J antibody, interferon, alpha 7 antibody, interferon alpha-7 antibody, interferon alpha 7 antibody, IFNA7 antibody, LOC741747 antibody, Ifna7 antibody

Background: IFNA7 belongs to the alpha/beta interferon family. IFNA7 is produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.

Molecular Weight: 22 kDa (MW of target protein)

Pathways: JAK-STAT Signaling, Hepatitis C