FUCA1 antibody (Middle Region)

Catalog No. ABIN634001

Product Details anti-FUCA1 Antibody

Target: FUCA1 (Fucosidase, alpha-L- 1, Tissue (FUCA1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FUCA1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FUCA1 antibody was raised against the middle region of FUCA1

Purification: Affinity purified

Immunogen: FUCA1 antibody was raised using the middle region of FUCA1 corresponding to a region with amino acids TNWPSPVSWNWNSKDVGPHRDLVGELGTALRKRNIRYGLYHSLLEWFHPL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FUCA1 Blocking Peptide, catalog no. 33R-9215, is also available for use as a blocking control in assays to test for specificity of this FUCA1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FUCA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FUCA1

Target: FUCA1 (Fucosidase, alpha-L- 1, Tissue (FUCA1))

Alternative Name: FUCA1 (FUCA1 Products)

Synonyms: FUCA antibody, FUCA1 antibody, 0610006A03Rik antibody, 9530055J05Rik antibody, Afuc antibody, Fuca antibody, fuca antibody, fuca1 antibody, ATFUC1 antibody, F24D13.11 antibody, F24D13_11 antibody, alpha-L-fucosidase 1 antibody, wu:fb02a09 antibody, zgc:101116 antibody, alpha-L-fucosidase 1 antibody, fucosidase, alpha-L- 1, tissue antibody, alpha-L-fucosidase 1 L homeolog antibody, alpha-L-fucosidase 1, tandem duplicate 2 antibody, FUCA1 antibody, Fuca1 antibody, fuca1.L antibody, fuca1 antibody, FUC1 antibody, LOC9317020 antibody, LOC100285202 antibody, fuca1.2 antibody

Background: Alpha-L-fucosidase (EC 3.2.1.51) is a lysosomal enzyme involved in the degradation of fucose-containing glycoproteins and glycolipids. At least 2 separate polymorphic alpha-L-fucosidases are recognised in man.

Molecular Weight: 54 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process