FUCA1 antibody (Middle Region)
-
- Target See all FUCA1 Antibodies
- FUCA1 (Fucosidase, alpha-L- 1, Tissue (FUCA1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FUCA1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FUCA1 antibody was raised against the middle region of FUCA1
- Purification
- Affinity purified
- Immunogen
- FUCA1 antibody was raised using the middle region of FUCA1 corresponding to a region with amino acids TNWPSPVSWNWNSKDVGPHRDLVGELGTALRKRNIRYGLYHSLLEWFHPL
- Top Product
- Discover our top product FUCA1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FUCA1 Blocking Peptide, catalog no. 33R-9215, is also available for use as a blocking control in assays to test for specificity of this FUCA1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FUCA1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FUCA1 (Fucosidase, alpha-L- 1, Tissue (FUCA1))
- Alternative Name
- FUCA1 (FUCA1 Products)
- Synonyms
- FUCA antibody, FUCA1 antibody, 0610006A03Rik antibody, 9530055J05Rik antibody, Afuc antibody, Fuca antibody, fuca antibody, fuca1 antibody, ATFUC1 antibody, F24D13.11 antibody, F24D13_11 antibody, alpha-L-fucosidase 1 antibody, wu:fb02a09 antibody, zgc:101116 antibody, alpha-L-fucosidase 1 antibody, fucosidase, alpha-L- 1, tissue antibody, alpha-L-fucosidase 1 L homeolog antibody, alpha-L-fucosidase 1, tandem duplicate 2 antibody, FUCA1 antibody, Fuca1 antibody, fuca1.L antibody, fuca1 antibody, FUC1 antibody, LOC9317020 antibody, LOC100285202 antibody, fuca1.2 antibody
- Background
- Alpha-L-fucosidase (EC 3.2.1.51) is a lysosomal enzyme involved in the degradation of fucose-containing glycoproteins and glycolipids. At least 2 separate polymorphic alpha-L-fucosidases are recognised in man.
- Molecular Weight
- 54 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-