APOH antibody
-
- Target See all APOH Antibodies
- APOH (Apolipoprotein H (Beta-2-Glycoprotein I) (APOH))
-
Reactivity
- Human, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This APOH antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ApoH antibody was raised using a synthetic peptide corresponding to a region with amino acids LWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGAD
- Top Product
- Discover our top product APOH Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ApoH Blocking Peptide, catalog no. 33R-5558, is also available for use as a blocking control in assays to test for specificity of this ApoH antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOH antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- APOH (Apolipoprotein H (Beta-2-Glycoprotein I) (APOH))
- Alternative Name
- ApoH (APOH Products)
- Synonyms
- B2G1 antibody, B2GP1 antibody, BG antibody, BETA2 antibody, BHF-1 antibody, MODY6 antibody, NEUROD antibody, bHLHa3 antibody, apoh antibody, APOH antibody, B2GPI antibody, beta-2-GPI antibody, beta2-GPI antibody, LOC100227913 antibody, apolipoprotein H antibody, neuronal differentiation 1 antibody, APOH antibody, NEUROD1 antibody, apoh antibody, Apoh antibody
- Background
- Apolipoprotein H has been implicated in a variety of physiologic pathways including lipoprotein metabolism, coagulation, and the production of antiphospholipid autoantibodies. APOH may be a required cofactor for anionic phospholipid binding by the antiphospholipid autoantibodies found in sera of many patients with lupus and primary antiphospholipid syndrome, but it does not seem to be required for the reactivity of antiphospholipid autoantibodies associated with infections.
- Molecular Weight
- 36 kDa (MW of target protein)
-