LYPD6 antibody (Middle Region)
-
- Target See all LYPD6 Antibodies
- LYPD6 (LY6/PLAUR Domain Containing 6 (LYPD6))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LYPD6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LYPD6 antibody was raised against the middle region of LYPD6
- Purification
- Affinity purified
- Immunogen
- LYPD6 antibody was raised using the middle region of LYPD6 corresponding to a region with amino acids RDSEHEGHKVCTSCCEGNICNLPLPRNETDATFATTSPINQTNGHPRCMS
- Top Product
- Discover our top product LYPD6 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LYPD6 Blocking Peptide, catalog no. 33R-7859, is also available for use as a blocking control in assays to test for specificity of this LYPD6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYPD6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LYPD6 (LY6/PLAUR Domain Containing 6 (LYPD6))
- Alternative Name
- LYPD6 (LYPD6 Products)
- Background
- LYPD6 contains 1 UPAR/Ly6 domain. The exact function of LYPD6 is not known.
- Molecular Weight
- 19 kDa (MW of target protein)
-