LYPD6 antibody (Middle Region)

Catalog No. ABIN633991

Product Details anti-LYPD6 Antibody

Target: LYPD6 (LY6/PLAUR Domain Containing 6 (LYPD6))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LYPD6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LYPD6 antibody was raised against the middle region of LYPD6

Purification: Affinity purified

Immunogen: LYPD6 antibody was raised using the middle region of LYPD6 corresponding to a region with amino acids RDSEHEGHKVCTSCCEGNICNLPLPRNETDATFATTSPINQTNGHPRCMS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LYPD6 Blocking Peptide, catalog no. 33R-7859, is also available for use as a blocking control in assays to test for specificity of this LYPD6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYPD6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LYPD6

Target: LYPD6 (LY6/PLAUR Domain Containing 6 (LYPD6))

Alternative Name: LYPD6 (LYPD6 Products)

Synonyms: zgc:101899 antibody, DKFZp459C1429 antibody, E130115E03Rik antibody, LY6/PLAUR domain containing 6 antibody, lypd6 antibody, LYPD6 antibody, Lypd6 antibody

Background: LYPD6 contains 1 UPAR/Ly6 domain. The exact function of LYPD6 is not known.

Molecular Weight: 19 kDa (MW of target protein)