CYP2B6 antibody (Middle Region)
-
- Target See all CYP2B6 Antibodies
- CYP2B6 (Cytochrome P450, Family 2, Subfamily B, Polypeptide 6 (CYP2B6))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CYP2B6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CYP2 B6 antibody was raised against the middle region of CYP2 6
- Purification
- Affinity purified
- Immunogen
- CYP2 B6 antibody was raised using the middle region of CYP2 6 corresponding to a region with amino acids QLFELFSGFLKYFPGAHRQVYKNLQEINAYIGHSVEKHRETLDPSAPKDL
- Top Product
- Discover our top product CYP2B6 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CYP2B6 Blocking Peptide, catalog no. 33R-7624, is also available for use as a blocking control in assays to test for specificity of this CYP2B6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CYP2B6 (Cytochrome P450, Family 2, Subfamily B, Polypeptide 6 (CYP2B6))
- Alternative Name
- CYP2B6 (CYP2B6 Products)
- Synonyms
- CPB6 antibody, CYP2B antibody, CYP2B7 antibody, CYP2B7P antibody, CYPIIB6 antibody, EFVM antibody, IIB1 antibody, P450 antibody, CPF3 antibody, CYP4F antibody, LTB4H antibody, CYP2B30 antibody, CYP2B11 antibody, CYPIIB11 antibody, 21-OH antibody, 21OH antibody, 21OHA antibody, 21OHB antibody, CYP21OH-A antibody, Cyp21 antibody, Cyp21-ps1 antibody, Cyp21B antibody, Cyp21a2-ps antibody, Cyp21a2ps antibody, Oh21-1 antibody, Oh21-2 antibody, CYP2B6 antibody, cytochrome P450 family 2 subfamily B member 6 antibody, cytochrome P450 family 4 subfamily F member 3 antibody, cytochrome P450, family 2, subfamily B, polypeptide 6 antibody, cytochrome P450 family 2 subfamily B member 6 L homeolog antibody, cytochrome P450 2B11 antibody, cytochrome P450, family 21, subfamily a, polypeptide 1 antibody, cytochrome P450 subfamily 2B antibody, cytochrome P450 2B11-like antibody, CYP2B6 antibody, CYP4F3 antibody, cyp2b6.L antibody, Cyp21a1 antibody, LOC100068603 antibody
- Background
- This gene, CYP2B6, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.
- Molecular Weight
- 56 kDa (MW of target protein)
-