Nucleobindin 1 antibody (C-Term)
-
- Target See all Nucleobindin 1 (NUCB1) Antibodies
- Nucleobindin 1 (NUCB1)
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Nucleobindin 1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Nucleobindin 1 antibody was raised against the C terminal of NUCB1
- Purification
- Affinity purified
- Immunogen
- Nucleobindin 1 antibody was raised using the C terminal of NUCB1 corresponding to a region with amino acids PAAHPEGQLKFHPDTDDVPVPAPAGDQKEVDTSEKKLLERLPEVEVPQHL
- Top Product
- Discover our top product NUCB1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Nucleobindin 1 Blocking Peptide, catalog no. 33R-6951, is also available for use as a blocking control in assays to test for specificity of this Nucleobindin 1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUCB1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Nucleobindin 1 (NUCB1)
- Alternative Name
- Nucleobindin 1 (NUCB1 Products)
- Background
- Nucleobindin, also known as calnuc, participates in Ca2+ storage in the Golgi, as well as in other biological processes that involve DNA-binding and protein-protein interactions.
- Molecular Weight
- 54 kDa (MW of target protein)
-