Nucleobindin 1 antibody (C-Term)

Catalog No. ABIN633980

Product Details anti-Nucleobindin 1 Antibody

Target: Nucleobindin 1 (NUCB1)

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Nucleobindin 1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Nucleobindin 1 antibody was raised against the C terminal of NUCB1

Purification: Affinity purified

Immunogen: Nucleobindin 1 antibody was raised using the C terminal of NUCB1 corresponding to a region with amino acids PAAHPEGQLKFHPDTDDVPVPAPAGDQKEVDTSEKKLLERLPEVEVPQHL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Nucleobindin 1 Blocking Peptide, catalog no. 33R-6951, is also available for use as a blocking control in assays to test for specificity of this Nucleobindin 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUCB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Nucleobindin 1

Target: Nucleobindin 1 (NUCB1)

Alternative Name: Nucleobindin 1 (NUCB1 Products)

Synonyms: nuc antibody, MGC69294 antibody, MGC81496 antibody, NUCB1 antibody, zgc:153192 antibody, DKFZp459O1814 antibody, B230337F23Rik antibody, C77483 antibody, Calnuc antibody, MTEST82 antibody, Nucb antibody, CALNUC antibody, NUC antibody, nucleobindin 1 antibody, nucleobindin 1 S homeolog antibody, nucb1 antibody, nucb1.S antibody, NUCB1 antibody, Nucb1 antibody

Background: Nucleobindin, also known as calnuc, participates in Ca2+ storage in the Golgi, as well as in other biological processes that involve DNA-binding and protein-protein interactions.

Molecular Weight: 54 kDa (MW of target protein)