FCN1 antibody
-
- Target See all FCN1 Antibodies
- FCN1 (Ficolin (Collagen/fibrinogen Domain Containing) 1 (FCN1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FCN1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- FCN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEA
- Top Product
- Discover our top product FCN1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FCN1 Blocking Peptide, catalog no. 33R-3578, is also available for use as a blocking control in assays to test for specificity of this FCN1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FCN1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FCN1 (Ficolin (Collagen/fibrinogen Domain Containing) 1 (FCN1))
- Alternative Name
- FCN1 (FCN1 Products)
- Synonyms
- FCNM antibody, FCNB antibody, FCN2 antibody, FCN1 antibody, ficolin 1 antibody, ficolin (collagen/fibrinogen domain containing) 1 antibody, ficolin-1 antibody, FCN1 antibody, Fcn1 antibody, LOC100069029 antibody
- Background
- The ficolin family of proteins are characterized by the presence of a leader peptide, a short N-terminal segment, followed by a collagen-like region, and a C-terminal fibrinogen-like domain. The collagen-like and the fibrinogen-like domains are also found separately in other proteins such as complement protein C1q, C-type lectins known as collectins, and tenascins. However, all these proteins recognise different targets, and are functionally distinct. Ficolin 1(FCN1) is predominantly expressed in the peripheral blood leukocytes, and has been postulated to function as a plasma protein with elastin-binding activity.
- Molecular Weight
- 32 kDa (MW of target protein)
- Pathways
- Complement System
-