ANGPTL5 antibody (N-Term)

Catalog No. ABIN633977

Product Details anti-ANGPTL5 Antibody

Target: ANGPTL5 (Angiopoietin-Like 5 (ANGPTL5))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ANGPTL5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ANGPTL5 antibody was raised against the N terminal of ANGPTL5

Purification: Affinity purified

Immunogen: ANGPTL5 antibody was raised using the N terminal of ANGPTL5 corresponding to a region with amino acids ASLDYLSNQVNELMNRVLLLTTEVFRKQLDPFPHRPVQSHGLDCTDIKDT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ANGPTL5 Blocking Peptide, catalog no. 33R-1512, is also available for use as a blocking control in assays to test for specificity of this ANGPTL5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANGPTL5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ANGPTL5

Target: ANGPTL5 (Angiopoietin-Like 5 (ANGPTL5))

Alternative Name: ANGPTL5 (ANGPTL5 Products)

Synonyms: AGF antibody, ARP5 antibody, ANGPTL5 antibody, bZ1P14.8 antibody, wu:fe36e01 antibody, si:rp71-1p14.8 antibody, angiopoietin like 5 antibody, angiopoietin like 6 antibody, angiopoietin-like 5 antibody, ANGPTL5 antibody, ANGPTL6 antibody, angptl5 antibody, Angptl5 antibody

Background: The function of ANGPTL5 has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 44 kDa (MW of target protein)