HMGCL antibody
-
- Target See all HMGCL Antibodies
- HMGCL (3-Hydroxymethyl-3-Methylglutaryl-CoA Lyase (HMGCL))
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HMGCL antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- HMGCL antibody was raised using a synthetic peptide corresponding to a region with amino acids LATEDLVYMLEGLGIHTGVNLQKLLEAGNFICQALNRKTSSKVAQATCKL
- Top Product
- Discover our top product HMGCL Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HMGCL Blocking Peptide, catalog no. 33R-4801, is also available for use as a blocking control in assays to test for specificity of this HMGCL antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HMGCL antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HMGCL (3-Hydroxymethyl-3-Methylglutaryl-CoA Lyase (HMGCL))
- Alternative Name
- HMGCL (HMGCL Products)
- Synonyms
- Afu7g01720 antibody, AO090038000541 antibody, AW476067 antibody, HL antibody, zgc:56248 antibody, 3-hydroxymethyl-3-methylglutaryl-CoA lyase S homeolog antibody, 3-hydroxymethyl-3-methylglutaryl-CoA lyase antibody, 3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase antibody, 3-hydroxy-3-methylglutaryl-Coenzyme A lyase antibody, hmgcl.S antibody, HMGCL antibody, AFUA_7G01720 antibody, NFIA_114450 antibody, ACLA_065820 antibody, AOR_1_910074 antibody, PMAA_004600 antibody, TSTA_103060 antibody, ARB_04874 antibody, TRV_06573 antibody, Hmgcl antibody, hmgcl antibody
- Background
- The HMGCL protein belongs to the HMG-CoA lyase family. It is a mitochondrial enzyme that catalyzes the final step of leucine degradation and plays a key role in ketone body formation. Mutations in this gene are associated with HMG-CoA lyase deficiency.
- Molecular Weight
- 36 kDa (MW of target protein)
-