RDH12 antibody

Catalog No. ABIN633966

Product Details anti-RDH12 Antibody

Target: RDH12 (Retinol Dehydrogenase 12 (All-Trans/9-Cis/11-Cis) (RDH12))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RDH12 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: RDH12 antibody was raised using a synthetic peptide corresponding to a region with amino acids HIGKIPFHDLQSEKRYSRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RDH12 Blocking Peptide, catalog no. 33R-3754, is also available for use as a blocking control in assays to test for specificity of this RDH12 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RDH12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RDH12

Target: RDH12 (Retinol Dehydrogenase 12 (All-Trans/9-Cis/11-Cis) (RDH12))

Alternative Name: RDH12 (RDH12 Products)

Synonyms: wu:fj43a10 antibody, zgc:92430 antibody, A930033N07Rik antibody, LCA13 antibody, LCA3 antibody, RP53 antibody, SDR7C2 antibody, DSSDR2 antibody, retinol dehydrogenase 12 (all-trans/9-cis/11-cis) antibody, retinol dehydrogenase 12 antibody, Retinol dehydrogenase 12 antibody, RDH12 antibody, rdh12 antibody, MAV_1968 antibody, CC1G_02720 antibody, Bm1_36660 antibody, PTRG_03574 antibody, PTRG_05326 antibody, PTRG_08067 antibody, LOC100282710 antibody, LOC100285880 antibody, LOC100226769 antibody, Rdh12 antibody

Background: RDH12 is an NADPH-dependent retinal reductase whose highest activity is toward 9-cis and all-trans-retinol. RDH12 also plays a role in the metabolism of short-chain aldehydes but does not exhibit steroid dehydrogenase activity. Defects in this gene are a cause of Leber congenital amaurosis type 3 (LCA3).

Molecular Weight: 35 kDa (MW of target protein)