Calreticulin 3 antibody (N-Term)
-
- Target See all Calreticulin 3 (CALR3) Antibodies
- Calreticulin 3 (CALR3)
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Calreticulin 3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Calreticulin 3 antibody was raised against the N terminal of CALR3
- Purification
- Affinity purified
- Immunogen
- Calreticulin 3 antibody was raised using the N terminal of CALR3 corresponding to a region with amino acids MAGPQQQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEK
- Top Product
- Discover our top product CALR3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Calreticulin 3 Blocking Peptide, catalog no. 33R-5666, is also available for use as a blocking control in assays to test for specificity of this Calreticulin 3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CALR3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Calreticulin 3 (CALR3)
- Alternative Name
- Calreticulin 3 (CALR3 Products)
- Synonyms
- 1700031L01Rik antibody, 6330586I20Rik antibody, Crt2 antibody, cspn antibody, CMH19 antibody, CRT2 antibody, CT93 antibody, A. thaliana calreticulin 3 antibody, AtCRT3 antibody, CALRETICULIN 3 antibody, EBS2 antibody, EMS-MUTAGENIZED BRI1 SUPPRESSOR 2 antibody, PRIORITY IN SWEET LIFE 1 antibody, PSL1 antibody, T27G7.13 antibody, T27G7_13 antibody, calreticulin 3 antibody, CALR antibody, calreticulin 3 antibody, CALR3 antibody, Calr3 antibody, CRT3 antibody
- Background
- Calreticulins, such as CALR3, are Ca(2+)-binding chaperones localized mainly in the endoplasmic/sarcoplasmic reticulum.
- Molecular Weight
- 42 kDa (MW of target protein)
- Pathways
- Activation of Innate immune Response
-