Plexin A4 antibody (Middle Region)
-
- Target See all Plexin A4 (PLXNA4) Antibodies
- Plexin A4 (PLXNA4)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Plexin A4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Plexin A4 antibody was raised against the middle region of PLXNA4
- Purification
- Affinity purified
- Immunogen
- Plexin A4 antibody was raised using the middle region of PLXNA4 corresponding to a region with amino acids TQEWIGVEGDPPGANIASQEQMLCVYLQCSSHKAISDQRVQPLLCCFLNV
- Top Product
- Discover our top product PLXNA4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Plexin A4 Blocking Peptide, catalog no. 33R-9241, is also available for use as a blocking control in assays to test for specificity of this Plexin A4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLXNA4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Plexin A4 (PLXNA4)
- Alternative Name
- Plexin A4 (PLXNA4 Products)
- Synonyms
- D204 antibody, wu:fd49b01 antibody, wu:fe15f03 antibody, PLXNA4A antibody, FAYV2820 antibody, PLEXA4 antibody, PLXNA4B antibody, PRO34003 antibody, 9330117B14 antibody, Plxa4 antibody, mKIAA1550 antibody, PLEX2 antibody, Plxna4 antibody, PLXNA4 antibody, plexin A4 antibody, plexin-A4 antibody, plxna4 antibody, PLXNA4 antibody, LOC100467706 antibody, Plxna4 antibody
- Background
- This protein mediates semaphorin receptor activity.
- Molecular Weight
- 57 kDa (MW of target protein)
- Pathways
- Regulation of Cell Size
-